DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58440

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_191403.1 Gene:AT3G58440 / 825013 AraportID:AT3G58440 Length:601 Species:Arabidopsis thaliana


Alignment Length:179 Identity:50/179 - (27%)
Similarity:74/179 - (41%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 YMWTINNFSFCREEMGEVLKSSTFS-AGANDKLKWCLRVNPKGLDEESKDYLSLYL-LLVSCNKS 551
            :.|.:..||..:::    ..|..|: ||.|    |.|....||...:.  |.|:|| |.......
plant    11 FTWVLEKFSSLKDQ----CYSPVFTVAGCN----WRLLSFLKGAKNDR--YFSVYLDLEPGSLPP 65

  Fly   552 EVRAKFKFSI-LNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKLTIFCE 615
            ..|.:.|||| |:.....|..:.....:...:...|||:.|:..:.|::.|.|.|..|:|||..|
plant    66 GWRREVKFSITLDNVCPNTDRVLGGPCFFDAKSNIWGFQDFLLLEKLVNIAEGFLVNDRLTIVAE 130

  Fly   616 VSVVADSV-------NISGQSNIVQFKVPECKLSEDLGNLFD-NEKFSD 656
            |.|:...|       .||.|.          ||.:|..:..| :|:.||
plant   131 VDVLPSIVVPLEPVKIISSQE----------KLDDDDDDCDDASEESSD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 39/134 (29%)
BTB_POZ_roadkill-like 637..757 CDD:349654 7/21 (33%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58440NP_191403.1 MATH 10..132 CDD:238068 37/130 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.