DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58430

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_191402.3 Gene:AT3G58430 / 825012 AraportID:AT3G58430 Length:471 Species:Arabidopsis thaliana


Alignment Length:234 Identity:52/234 - (22%)
Similarity:90/234 - (38%) Gaps:74/234 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 SEVRAKFKFSILNAKREETK-AMESQRAYRFVQGKDWGFKKFIRRDF---LLDEANGLLPEDKLT 611
            ||| .|.:.:|:|...|:.. :.||:..:. .|....|:      .|   ||.|..|.|..:.|.
plant   249 SEV-VKARLTIVNQLSEKLSISKESEHCFD-EQNPTLGY------TFPYELLVEDGGFLVNEDLM 305

  Fly   612 IFCEV---SVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAIL 673
            |..||   |.|.:..:..|:.::..|:|...:: |.:.::|  |:..|:.:     ||:|....|
plant   306 IIVEVIGASDVFEDSSTQGKVDVNGFQVLPSQV-EYVRSIF--ERHPDIAV-----EFRAKNQHL 362

  Fly   674 AARSDVFA-------------------------------AMFEHEMEERKLNRVAITDVDHEVLK 707
            .....:|.                               |.|:.:..|:||::|  .:...:.|.
plant   363 RTSCMIFLLSLIETLCQSLEELSNEDLVEADIALTYVKDAGFKVDWLEKKLDQV--KEKKEKELS 425

  Fly   708 EMLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEE 746
            :|::         |::|.|.||         |||..|.:
plant   426 DMVQ---------LQEMEDHLL---------KLKQSCSD 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 23/76 (30%)
BTB_POZ_roadkill-like 637..757 CDD:349654 26/141 (18%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58430NP_191402.3 MATH 8..132 CDD:238068
MATH <230..310 CDD:238068 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.