DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58420

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_191401.1 Gene:AT3G58420 / 825011 AraportID:AT3G58420 Length:294 Species:Arabidopsis thaliana


Alignment Length:260 Identity:55/260 - (21%)
Similarity:86/260 - (33%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 KFSYMWTINNFSFCREE---MGEVLKSSTFSAGANDKLKWCLRVNPKG-------------LDEE 534
            ||.  |.|.:||..:.|   ...||.|.:         ||.|.|.|||             |..|
plant     8 KFG--WVIKDFSSLQSEKCCSVPVLISES---------KWRLIVFPKGNNSEYFVRFYETKLTRE 61

  Fly   535 SKDYLSL---YLLLVSCNKSEVRAKFKFSILNAKREETK------------AMESQRAYRFVQGK 584
            |:..|:.   ...||....:.....|.||.|...|....            ::..:..:.| .||
plant    62 SRQSLAFDEEIFGLVFMTSALTPFCFFFSFLEMARPHRPLSPFFIHSNILVSLSGKTEHCF-DGK 125

  Fly   585 D--WGFKKFIRRDFLLDEANGLLPEDKLTIFCEVS--------------------VVADSVNISG 627
            .  |||...:....|.::..|.|...::.|..|:.                    |...:.|:..
plant   126 STTWGFPAMLSLSKLHEKDGGFLVNGEVMIVAELDVFEVIGTLDESEKSEEASKLVTKKTENLGA 190

  Fly   628 QSNIVQFKVPECKLSEDLGNLFDNEK-----------FSDVTLSVGGREFQAHKAILAARSDVFA 681
            :||.:..|....|.|.::..:.::.|           |..:...:.|...:||:..|||:...|:
plant   191 ESNELLKKTSPPKESNNVKQVENSVKTSPKNKRMWVTFLIIVFFLIGALGKAHEKHLAAKERNFS 255

  Fly   682  681
            plant   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 40/187 (21%)
BTB_POZ_roadkill-like 637..757 CDD:349654 11/56 (20%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58420NP_191401.1 MATH 11..160 CDD:238068 37/158 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.