DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58380

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_191397.1 Gene:AT3G58380 / 825007 AraportID:AT3G58380 Length:307 Species:Arabidopsis thaliana


Alignment Length:104 Identity:32/104 - (30%)
Similarity:50/104 - (48%) Gaps:24/104 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 LNAKREETKAMESQRAYRFV-QGKDWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNI 625
            |.|:..:|...|:..|..|| ||   |||.    |:|         |.||.   ||.....:|: 
plant   213 LPAELSDTDLDEASIAVLFVSQG---GFKV----DWL---------EKKLK---EVKEKKKNVD- 257

  Fly   626 SGQSNIVQFKVPECKLSE---DLGNLFDNEKFSDVTLSV 661
            :|::.:.|.:....||::   ||.::.|.||.:|:|.:|
plant   258 NGKARLQQIEEDLQKLNQKRLDLKDILDKEKANDLTANV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 19/59 (32%)
BTB_POZ_roadkill-like 637..757 CDD:349654 10/28 (36%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58380NP_191397.1 MATH 8..132 CDD:238068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.