DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and RTM3

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_567063.1 Gene:RTM3 / 825004 AraportID:AT3G58350 Length:301 Species:Arabidopsis thaliana


Alignment Length:270 Identity:62/270 - (22%)
Similarity:101/270 - (37%) Gaps:83/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 WTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYL---LLVSCNKSE 552
            |||.||:   ..:.:::.|..|..|.   .||.||..|||.:..:.  |||:|   :..|.....
plant    11 WTIKNFA---SLLSDLIYSDHFVVGG---CKWHLRAYPKGYNNANS--LSLFLGVAVPTSLPSGW 67

  Fly   553 VR-AKFKFSILNA---KREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKLTIF 613
            .| .||:.:::|.   |..::|..|.::.:. .:..:||.......:.:..:.:|.|...:|.|.
plant    68 RRHTKFRLTLVNQLSDKLSQSKLNELEQWFD-EKTTNWGLSSMCPLNEIHAKDSGFLLNGELKIV 131

  Fly   614 CEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSD 678
            .|:.|:                       |.:|.|...|:.|.:|.:|....||    :|.:::.
plant   132 VEIK
VL-----------------------ETIGKLDVTEETSTITETVDVNGFQ----LLPSQAK 169

  Fly   679 VFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNL-------------------EKM 724
            ..:.||                ..|..|...||    .|.|||                   ::|
plant   170 SVSRMF----------------AKHPELASDLR----PKNPNLRTGYMSLLLSLIETLSQLPQQM 214

  Fly   725 A-DDLLAAAD 733
            : ||||.|.|
plant   215 SKDDLLDAYD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 35/136 (26%)
BTB_POZ_roadkill-like 637..757 CDD:349654 27/117 (23%)
BACK_roadkill_like 752..825 CDD:350595
RTM3NP_567063.1 MATH 8..135 CDD:238068 34/132 (26%)
PEARLI-4 <156..279 CDD:253129 21/93 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.