DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58330

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_191392.1 Gene:AT3G58330 / 825002 AraportID:AT3G58330 Length:173 Species:Arabidopsis thaliana


Alignment Length:151 Identity:30/151 - (19%)
Similarity:60/151 - (39%) Gaps:39/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 DSVNISG------QSNIVQ---FKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAIL--- 673
            ::|.::|      |.|:|.   .|.|:...:.||.|......:.||.:.:.....|:.||:.   
plant    28 ETVEVNGFHVLPSQENLVSQMLKKHPDLTSNFDLKNQQLKNAYMDVLVDISETLSQSTKALSMED 92

  Fly   674 --AARSDVF--------AAMFEHEMEE-------RKLNRVAITDVDHEVLKEMLRFIYTGKAPNL 721
              .|.|.:|        ......:::|       ::::.|.|.:::.:|.|..|         .|
plant    93 LDKAESTLFDLTKAGLKVGWLRQKLDEAYLKKEKQRISGVRIRELEEQVNKRKL---------TL 148

  Fly   722 EKMADDL-LAAADKYALEKLK 741
            ..:..|| ...|::.::.:||
plant   149 SDLESDLKKEKANQLSMAQLK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 30/151 (20%)
BTB_POZ_roadkill-like 637..757 CDD:349654 24/126 (19%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58330NP_191392.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.