DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58320

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_191391.1 Gene:AT3G58320 / 825001 AraportID:AT3G58320 Length:224 Species:Arabidopsis thaliana


Alignment Length:275 Identity:55/275 - (20%)
Similarity:94/275 - (34%) Gaps:87/275 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 VNECQASQTARV----------------TSNLHASSSTMAVSRVPSPPLPEVNTPVA--ENWCYT 480
            |:|.....||:.                .|:||...|.:..|:.......|.|...:  |:|.  
plant     8 VSEADTDDTAKEDLFEDGTVEEYPDDDDASSLHQWKSMVYTSKTVENFGTECNNKESFYESWW-- 70

  Fly   481 QVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLL 545
               :..|.....:|.|.....::..|  |..|....:..:.:    .||. .:..|.|:...|.|
plant    71 ---ISDFLETIDVNGFQVLASQVQSV--SQIFKRHPDTAIGF----RPKN-QQIRKAYMDALLSL 125

  Fly   546 VS--CNKSEVRAKFKFS---ILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLL 605
            :.  |...:     |.|   :.||  :||          .|...|.|||    .|:|..:.|.:.
plant   126 IETLCQSPD-----KLSDDDLSNA--DET----------LVDLIDVGFK----LDWLKTKLNDVS 169

  Fly   606 PEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHK 670
            .:.||                |:|::|:.:..|.:|          :|...:.|.:..:..:..:
plant   170 EKKKL----------------GESSVVRLETMEEQL----------QKLKHMVLDLESQMQKEKE 208

  Fly   671 AILAARS-----DVF 680
            .:||||:     |:|
plant   209 KVLAARAPLSFKDIF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 29/142 (20%)
BTB_POZ_roadkill-like 637..757 CDD:349654 10/49 (20%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58320NP_191391.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.