DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58220

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001118854.1 Gene:AT3G58220 / 824991 AraportID:AT3G58220 Length:453 Species:Arabidopsis thaliana


Alignment Length:237 Identity:52/237 - (21%)
Similarity:87/237 - (36%) Gaps:60/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 VNTPVAENWCYTQVKVVKFSYMWTINNFSFCREEMG-EVLKSSTFSAGANDKLKWCLRVNPKGLD 532
            :.:|:.:|           .:.|.|.:||    .:| ..:.|..|..|.   .||.|...|.|  
plant     4 IGSPLGKN-----------EFSWVIKDFS----SLGVRAIYSDEFVIGG---CKWRLIAYPMG-- 48

  Fly   533 EESKDYLSLYLLLVSCNKS----EVRAKFKFSILNAKREETKAMESQRAYR----FVQ-GKDWGF 588
            ...|.|:|||:.:......    .:..:.:..::|    ......||:.||    |.| ...||:
plant    49 NRIKKYMSLYVEVADSKHLPSGWSINTELRMEVVN----HNLYKPSQQKYRKNLWFDQKTPSWGY 109

  Fly   589 KKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEK 653
            |..||...|..| .|.|...::||..::    |...:.|       ||...::||: |       
plant   110 KTMIRHSKLSGE-EGFLVSGEVTIVVKI----DVYRVFG-------KVAAIEISEE-G------- 154

  Fly   654 FSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNR 695
                  |..|.|:::.:.......:.:....|.:.|:|.:.|
plant   155 ------SKEGYEYESEEVYKKESEEGYKYESEEDYEKRPIER 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 36/147 (24%)
BTB_POZ_roadkill-like 637..757 CDD:349654 10/59 (17%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58220NP_001118854.1 MATH 13..137 CDD:238068 36/141 (26%)
PTZ00121 <151..>306 CDD:173412 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.