DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G58200

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_191379.1 Gene:AT3G58200 / 824989 AraportID:AT3G58200 Length:319 Species:Arabidopsis thaliana


Alignment Length:278 Identity:64/278 - (23%)
Similarity:107/278 - (38%) Gaps:60/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 YMWTINNFSFCREEMG-EVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLL-----VS 547
            :.|.|.|||    .:| |.:.|..|..|:   .||.|...|||:.:..  ..||:|::     :.
plant     9 FRWVIKNFS----SLGSERVFSDIFVVGS---CKWRLMAYPKGVRDNR--CFSLFLVVTDFKTLP 64

  Fly   548 CNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKLTI 612
            |:... ..:.:.:::|...||...::..:.:...:...|||...:....|..|..|.|..:::.|
plant    65 CDWKR-HTRLRLNVVNQLSEELSILKETQMWFDQKTPAWGFLAMLPLTELKAENGGFLVNEEVKI 128

  Fly   613 FCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARS 677
            ..||.||                       |.||.|.::|:.:.....|....|...|.:|...|
plant   129 VVEVDVV-----------------------EALGKLEESEEATQPLKKVKLEAFVESKGLLKETS 170

  Fly   678 ---------DVFAAM-----FEHEMEERKLNRVAITDVDHEVLKE-----MLRFIYTGKAPNLEK 723
                     :||..:     |...:.||.....:|.....:.|:.     :|..|.| ...:||:
plant   171 SVKEEIIDVNVFHVLPSQVEFVSRVFERYPEIASIFQAKKQHLRTACMYVLLSLIET-LCKSLEE 234

  Fly   724 MADDLLAAADKYALEKLK 741
            :::|.|...|. ||:.||
plant   235 LSNDDLVGGDN-ALQYLK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 35/137 (26%)
BTB_POZ_roadkill-like 637..757 CDD:349654 29/124 (23%)
BACK_roadkill_like 752..825 CDD:350595
AT3G58200NP_191379.1 MATH 7..118 CDD:238068 28/118 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.