DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G29740

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_189617.1 Gene:AT3G29740 / 822660 AraportID:AT3G29740 Length:87 Species:Arabidopsis thaliana


Alignment Length:71 Identity:22/71 - (30%)
Similarity:35/71 - (49%) Gaps:11/71 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   645 LGNLFDNEKFSDVTLSVG-----GREFQAHKAILAARSDVFAAMFEHEMEERK----LNRVAITD 700
            |..:...::..||.|..|     |....|||.:|:|||:||..:.  |.||.|    |:.:.:::
plant    14 LARILKEQRQVDVRLKAGDSDQKGVSISAHKLVLSARSEVFKMIL--ETEEIKATTTLDTITLSE 76

  Fly   701 VDHEVL 706
            :.|..|
plant    77 LKHTEL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654 22/71 (31%)
BACK_roadkill_like 752..825 CDD:350595
AT3G29740NP_189617.1 BTB_POZ 18..>87 CDD:453885 21/67 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.