DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G28220

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_189462.1 Gene:AT3G28220 / 822448 AraportID:AT3G28220 Length:370 Species:Arabidopsis thaliana


Alignment Length:153 Identity:46/153 - (30%)
Similarity:66/153 - (43%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 TPVAENWCYTQVKVVKFS-------YMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNP 528
            |.|...|     :|..|:       |.||:.|||...:   :...|..|..|..   .|.|:|.|
plant   219 TEVFNKW-----EVFSFTKSLHDRLYKWTLPNFSSLEK---QYYVSDKFVIGGR---SWALKVYP 272

  Fly   529 KGLDEESKDYLSLYLLLVSCNK-SEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFI 592
            .|..|...:.||||::.|.... .::..|.|..|:|  :.::|.||.:......|...|||:||:
plant   273 SGDGEGQGNSLSLYVVAVDVKPYDKIYLKAKLRIIN--QRDSKHMEKKVESWSDQANSWGFQKFV 335

  Fly   593 RRDFLLDEANGLLPEDKLTIFCE 615
            ....|.|.:.|||..|.|.:..|
plant   336 PFADLKDTSKGLLVNDTLKMEIE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 43/141 (30%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT3G28220NP_189462.1 MATH 82..216 CDD:238068
MATH 239..360 CDD:238068 41/128 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.