DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G22080

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_188846.3 Gene:AT3G22080 / 821770 AraportID:AT3G22080 Length:314 Species:Arabidopsis thaliana


Alignment Length:175 Identity:46/175 - (26%)
Similarity:73/175 - (41%) Gaps:39/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 VPSPPLPEVNTPVAENW-------CYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGAND 518
            |.:||         .||       ..:|.|     :.||:.|||   |....|..|..||.   .
plant   159 VAAPP---------TNWEIHTLHEALSQPK-----FFWTVKNFS---ELNNNVYTSGNFSM---R 203

  Fly   519 KLKWCLRVNPKGLDEESKDYLSLYLLL---VSCNKSE---VRAKFKFSILNAKREETKAMESQRA 577
            :.||.|::.|||..:..:.:|||||.|   .:..:||   |:|:.:..........|..:.|   
plant   204 ERKWVLKLYPKGDVKGDRKWLSLYLYLDQSETLKESEKIFVQAQLRVLDPRGSNHVTHKISS--- 265

  Fly   578 YRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADS 622
            :.......||::||:.   |.:.....|.:|.|.:..:|.||:::
plant   266 WYTSSNTAWGYRKFVS---LAEIPKAYLDKDTLKVQIDVEVVSEA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 40/143 (28%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT3G22080NP_188846.3 MATH 20..157 CDD:238068
MATH 178..302 CDD:238068 37/140 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.