DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT3G20370

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_566660.1 Gene:AT3G20370 / 821582 AraportID:AT3G20370 Length:379 Species:Arabidopsis thaliana


Alignment Length:262 Identity:58/262 - (22%)
Similarity:101/262 - (38%) Gaps:73/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 NNFSFCREEMGEVLKSS--------TFSAGANDKLKWCLRVNPKGLDEES-KDYLSLYLLL--VS 547
            :::|...|....:|||:        .||.|.   ..|.|.|.|.|..::| ..|||||:.:  .:
plant    86 SSYSLKMESFNTLLKSTYTEKYVSRPFSVGG---YNWTLVVFPNGNKKDSGSGYLSLYVAIDNST 147

  Fly   548 CNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKD----------WGFKKFIRRDFLLDEAN 602
            ..:.|:.|..:|.|.|         :::|.|..:|..|          |||.:.:..|...|...
plant   148 LGQQEIYADLRFYIFN---------KNERKYFTIQDTDVWKFSVFKTMWGFSQVLPIDTFKDPTK 203

  Fly   603 GLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLS-------EDLGNLFDNEKFSDVTLS 660
            |.|.:..   .||..|.....::..:|.:  |.|.|..|:       .....|..|...|:| .|
plant   204 GYLYDGD---HCEFGVDVTMPSLYEKSEL--FSVTENFLNPRFTWTIRGFSTLLKNSYLSEV-FS 262

  Fly   661 VGGREFQAH-----------KAILAARSDVFAAMFEHEM-----------EERKLNRVAITDVDH 703
            :|||.:...           ||:     .::..:..:|:           :.|.||::.:::::.
plant   263 IGGRSWNIQINPSGLGTGEGKAL-----SMYLGLNVNEIFRPYEKIYVRAKLRALNQLNLSNIER 322

  Fly   704 EV 705
            |:
plant   323 EL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 38/147 (26%)
BTB_POZ_roadkill-like 637..757 CDD:349654 17/98 (17%)
BACK_roadkill_like 752..825 CDD:350595
AT3G20370NP_566660.1 MATH 87..219 CDD:238068 38/146 (26%)
MATH 239..369 CDD:238068 15/92 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.