DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT2G42470

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_181775.2 Gene:AT2G42470 / 818847 AraportID:AT2G42470 Length:304 Species:Arabidopsis thaliana


Alignment Length:151 Identity:34/151 - (22%)
Similarity:58/151 - (38%) Gaps:47/151 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 WLAKPFDYHGVNQCCQAHDDHY---------YHHTLSREDADRVFCDCLEENANWFVRNLIEPIF 96
            :|.:..||..     ||.|..:         .::.|.:|...|| .:||.||....:|..:|.: 
plant   707 YLEEELDYRK-----QALDQAHMKIQELEATLYNALQQEPGRRV-SECLNENQREDLRAAVEKL- 764

  Fly    97 CKSVQTYAIWQKFTNQNSWSSQFTIKPPTTTTTTESPLNYYLELL---HQREREFELRKEQEARR 158
                    ..|.......:.||.              |:..:|||   .||.||.|.:.:.:.|:
plant   765 --------RRQILRQSREFDSQI--------------LHERMELLQQAQQRIRELEDKIDFQKRQ 807

  Fly   159 REELERE------NERFRQEW 173
            .:|||.:      :::|:|.:
plant   808 LKELEEKHSFCGLDDQFQQRY 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT2G42470NP_181775.2 MATH 8..124 CDD:238068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.