DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and BPM3

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_030522.1 Gene:BPM3 / 818561 AraportID:AT2G39760 Length:408 Species:Arabidopsis thaliana


Alignment Length:355 Identity:112/355 - (31%)
Similarity:182/355 - (51%) Gaps:33/355 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 VKVVKFSYMWTINNFSFCR-EEMGEVLKSSTFSAGANDKLKWCLRVNPKGLD-EESKDYLSLYLL 544
            ::.|..|:.:||..:|..: ...|:.::|..||.|..|   |.:...|.|.: |:...|:||::.
plant    20 IETVNGSHQFTIQGYSLAKGMSPGKFIQSDIFSVGGYD---WAIYFYPDGKNPEDQSSYISLFIA 81

  Fly   545 LVSCNKSEVRAKFKFSILNAKREE--------TKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEA 601
            |.| :.:::||.|:.::::...:.        .:|:|........:|..||:|:|.:|..|  |.
plant    82 LAS-DSNDIRALFELTLMDQSGKGKHKVHSHFDRALEGGPYTLKYKGSMWGYKRFFKRSAL--ET 143

  Fly   602 NGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREF 666
            :..|.:|.|.|.|.|.||...:....|..||   :|...:.:.|.:|.|:|...|:...||...:
plant   144 SDYLKDDCLVINCTVGVVRARLEGPKQYGIV---LPLSNMGQGLKDLLDSEVGCDIAFQVGDETY 205

  Fly   667 QAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEK-------- 723
            :|||.||||||.||.|.|...:....::|:.|.|::..:.|.||.||||...||:.:        
plant   206 KAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEPSIFKAMLSFIYTDVLPNVHEITGSTSAS 270

  Fly   724 ----MADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHA 784
                |...||||||.|.|.:||::||..||..|.|:..|.||.||:.|...||||..::|:.:.|
plant   271 SFTNMIQHLLAAADLYDLARLKILCEVLLCEKLDVDNVATTLALAEQHQFLQLKAFCLEFVASPA 335

  Fly   785 T--DVMETSGWQNMITTHSHLIAEAFRALA 812
            .  .||::.|::::..:...|::|....:|
plant   336 NLGAVMKSEGFKHLKQSCPTLLSELLNTVA 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 41/147 (28%)
BTB 645..749 CDD:279045 45/115 (39%)
BTB 656..752 CDD:197585 43/107 (40%)
SPOP_C 752..814 CDD:269807 20/63 (32%)
BPM3NP_030522.1 MATH 25..158 CDD:238068 37/138 (27%)
BTB_POZ_BPM_plant 180..300 CDD:349589 45/119 (38%)
BACK_AtBPM-like 300..363 CDD:350516 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2843
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2651
orthoMCL 1 0.900 - - OOG6_101509
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.