DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT2G15710

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_179173.1 Gene:AT2G15710 / 816065 AraportID:AT2G15710 Length:365 Species:Arabidopsis thaliana


Alignment Length:122 Identity:31/122 - (25%)
Similarity:56/122 - (45%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 QVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLL 545
            ::.::|||  |::.:||..:||.   ..|..||.|..   .|.|::.|||.....|.:||::|.|
plant   247 KLDILKFS--WSVKDFSVLKEEF---YVSERFSMGGR---LWDLQMYPKGDPRRDKKWLSIFLRL 303

  Fly   546 VSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKF-----IRRDFL 597
            .......|..|. :.|.:     .:.::....:...:.|.||:.:|     :|:.:|
plant   304 SGSETLTVDEKI-YVIAH-----LRVLDPLGNWFRDRNKGWGYLEFLSFSKLRKSYL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 31/120 (26%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT2G15710NP_179173.1 MATH 100..230 CDD:238068
MATH 251..361 CDD:238068 31/118 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.