DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT2G05400

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001323545.1 Gene:AT2G05400 / 815088 AraportID:AT2G05400 Length:217 Species:Arabidopsis thaliana


Alignment Length:192 Identity:48/192 - (25%)
Similarity:78/192 - (40%) Gaps:49/192 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 DWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSV--VADSVNISGQSNIV-------QFKVPECK 640
            ||||.:.|....|..| .|||...:||:..:|.|  |...:::|.:|:.|       .|:|...:
plant    18 DWGFTEMISLTELHAE-EGLLRNGELTVVAKVEVLEVVGKLDVSEESSPVIETIDVNGFQVLPSQ 81

  Fly   641 LSEDLGNLFDNE----------------KFSDVTLSVGGREFQAHKAIL--------AARSDVFA 681
            : |...:||:..                .:.:|.||:.....|:.:.:.        ||.:.:..
plant    82 V-EYAKSLFERHLDIASKFRPKNPYLKTAYMNVLLSLTQTICQSPQELSNDDLSDAGAALAYLRE 145

  Fly   682 AMFEHEMEERKLNRV------------AITDVDHEVLKEMLRFIYTGKAPNLEKMADDLLAA 731
            |.||.:..|:|||.|            .|.|:|..|  :.|:..|......::|...:||||
plant   146 AGFELDWLEKKLNEVKEKKKKEEACLAEIQDMDEHV--KPLKKKYLDLEAQIDKKKAELLAA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 15/37 (41%)
BTB_POZ_roadkill-like 637..757 CDD:349654 28/131 (21%)
BACK_roadkill_like 752..825 CDD:350595
AT2G05400NP_001323545.1 MATH <8..49 CDD:238068 12/31 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.