DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT2G04190

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_178503.2 Gene:AT2G04190 / 814956 AraportID:AT2G04190 Length:411 Species:Arabidopsis thaliana


Alignment Length:214 Identity:57/214 - (26%)
Similarity:89/214 - (41%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 TINNFSFCREEMG--EVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCNKSE-- 552
            ||.|||   |.:|  |..:||.|.|....|.:..|.||....|..| :::||||      :||  
plant   125 TITNFS---EIIGREEPYESSVFEAYFEHKWRLILYVNGNQNDGGS-NHISLYL------RSEET 179

  Fly   553 --------VRAKFKFSILNAKREE--TKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPE 607
                    :....|..:.|.|:::  |.....|:.|.: :.|:||:.|.|.....||.:.|.|.:
plant   180 DHLTYDGSINFVLKLFVYNGKQDKYLTVTDGIQKRYNY-KNKEWGYGKLIPLSTFLDTSQGYLEQ 243

  Fly   608 DKLTIFCEVSV-----VADSVNI--SGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVG--- 662
            |..:...|:.:     |.:.|..  :..:|:..:|:......||:....|:....|....:|   
plant   244 DTASFGAEIFLCPPIQVQEKVTFISNPPNNVFTWKILHFSTLEDIVYYSDDFLVEDRYWRLGVNP 308

  Fly   663 -----GREFQAHKAILAAR 676
                 ||. ||.|..|.|:
plant   309 KGTGDGRS-QAIKIFLYAQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 42/147 (29%)
BTB_POZ_roadkill-like 637..757 CDD:349654 12/48 (25%)
BACK_roadkill_like 752..825 CDD:350595
AT2G04190NP_178503.2 MATH 123..252 CDD:238068 40/137 (29%)
MATH 275..400 CDD:238068 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.