DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT2G04170

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_178502.2 Gene:AT2G04170 / 814954 AraportID:AT2G04170 Length:420 Species:Arabidopsis thaliana


Alignment Length:185 Identity:49/185 - (26%)
Similarity:71/185 - (38%) Gaps:48/185 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 MW----------TINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKG-LDEESKDYLSLYL 543
            ||          ||.:||..:.. ||..:||.|.||.   .||.|.:...| .::...:::|||:
plant   123 MWRDERPSNKILTITSFSVIKGR-GEPYESSVFEAGG---YKWRLVLYVNGNQNDGGNNHISLYV 183

  Fly   544 LLVSCNKS----EVRAKFKFSILNAKREETKAMESQRAYRFVQG----------KDWGFKKFIRR 594
            .:......    ||..:.|..:.|.|         ||.|..|:.          |:||:.|.|..
plant   184 RIEETESLPKGWEVNVELKLFVYNGK---------QRKYLIVKDGIVKRYNDAKKEWGYGKLIPL 239

  Fly   595 DFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLF 649
            ...||...|.|.:|..:...|:        .||.:..||.||  ..:|....|:|
plant   240 TTFLDTNEGYLEQDIASFGAEI--------FSGTAVQVQEKV--TFISNPPNNVF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 40/155 (26%)
BTB_POZ_roadkill-like 637..757 CDD:349654 3/13 (23%)
BACK_roadkill_like 752..825 CDD:350595
AT2G04170NP_178502.2 MATH 133..261 CDD:238068 37/140 (26%)
MATH 284..409 CDD:238068 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.