DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and klhl40b

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001410734.2 Gene:klhl40b / 795319 ZFINID:ZDB-GENE-060227-1 Length:618 Species:Danio rerio


Alignment Length:114 Identity:31/114 - (27%)
Similarity:58/114 - (50%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 LSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEV 705
            |.:.|.:|.:::...|..|.:..:||..|:.:|||.|..|.|.|:..:||.|...:.:.||:..|
Zfish    19 LQDGLYDLLESDMMVDCVLKIKDKEFPCHRLVLAACSSYFRAFFKSGVEESKQREIVLEDVEPGV 83

  Fly   706 LKEMLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSV 754
            :..:|:::||......|:...|:.|.::...:..:..:|...|...||:
Zfish    84 MGIILKYLYTSNINVTEQNVQDIFALSNMLQIPSIFTVCVSFLQKRLSL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654 31/114 (27%)
BACK_roadkill_like 752..825 CDD:350595 2/3 (67%)
klhl40bNP_001410734.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..297
Kelch 1 356..408
Kelch 2 409..458
Kelch 3 459..506
Kelch 4 508..553
Kelch 5 555..608
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.