DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and KLHL11

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_060613.1 Gene:KLHL11 / 55175 HGNCID:19008 Length:708 Species:Homo sapiens


Alignment Length:162 Identity:43/162 - (26%)
Similarity:76/162 - (46%) Gaps:12/162 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 FSDVTL---SVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHE------VLKEM 709
            |.|:||   ..|||||:||:::|||.::.|..:...:..|.:..||.:.....|      .::.:
Human    93 FCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAV 157

  Fly   710 LRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKA 774
            :.::|||:.........::|..||::.|.:||..|.|.|...|.:........||.:::..||..
Human   158 IEYMYTGRIRVSTGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLAL 222

  Fly   775 QTIDFINTHATDVMETSGWQNMITTHSHLIAE 806
            :..|.|..:...|::.   :...|...|||.:
Human   223 KAADMIRRNFHKVIQD---EEFYTLPFHLIRD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB 645..749 CDD:279045 30/103 (29%)
BTB 656..752 CDD:197585 30/104 (29%)
SPOP_C 752..814 CDD:269807 12/55 (22%)
KLHL11NP_060613.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..70
BTB_POZ_KLHL11 71..205 CDD:349550 32/111 (29%)
PHA03098 90..553 CDD:222983 43/162 (27%)
BACK_KLHL11 200..287 CDD:350526 12/55 (22%)
Kelch 1 360..407
KELCH repeat 399..439 CDD:276965
Kelch 2 408..453
KELCH repeat 443..488 CDD:276965
Kelch 3 455..501
KELCH repeat 491..541 CDD:276965
Kelch 4 503..556
KELCH repeat 567..649 CDD:276965
Kelch 5 610..661
Kelch 611..657 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.