DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and enc1.2

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001008029.1 Gene:enc1.2 / 493391 XenbaseID:XB-GENE-5914613 Length:588 Species:Xenopus tropicalis


Alignment Length:42 Identity:12/42 - (28%)
Similarity:18/42 - (42%) Gaps:5/42 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TNQNSWSSQFTIKPPTTTTTTESPLNYYLELLHQREREFELR 151
            |..|:.||     |..:..|.:|..|..:..|.|...:.||:
 Frog    49 TINNNCSS-----PVDSGNTEDSKTNLIVNYLPQNMTQEELK 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
enc1.2NP_001008029.1 BTB_POZ 6..152 CDD:453885 12/42 (29%)
PHA03098 48..574 CDD:222983 12/42 (29%)
KELCH repeat 329..373 CDD:276965
KELCH repeat 377..430 CDD:276965
KELCH repeat 433..479 CDD:276965
KELCH repeat 481..572 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.