DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and Tdpoz5

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_997156.2 Gene:Tdpoz5 / 399676 MGIID:3027905 Length:340 Species:Mus musculus


Alignment Length:331 Identity:173/331 - (52%)
Similarity:227/331 - (68%) Gaps:2/331 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 NWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLS 540
            ||.||.:.|.:|.|:|||.|||.|.:.:...:.|..||..|||::.||||.:|.|:||.|:.|:|
Mouse     9 NWGYTHISVKEFCYVWTIRNFSPCIDGIRRTITSPVFSLEANDEVTWCLRAHPNGVDEVSECYMS 73

  Fly   541 LYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLL 605
            ::|.|:||.||.|.||::|.|..::.|:.:.|:|...:.|.:.:..||||||..|||:......|
Mouse    74 VFLELLSCRKSPVWAKYEFWITTSQGEKYQCMKSFNVHSFQKNQYRGFKKFILGDFLISHPRRFL 138

  Fly   606 PEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHK 670
            ||:|||:.|:||:|.....:.||:.....|.|...|::|||.|::|..|:|..|.|.|.||:|||
Mouse   139 PENKLTLCCKVSIVGSVFGMPGQNITPAIKDPRHLLTDDLGELWENSLFTDCCLLVAGHEFRAHK 203

  Fly   671 AILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLE--KMADDLLAAAD 733
            |||||||.||.||||||||||..|...|.|:|.:|.|||:.||||||||:|:  .||.|:|.|||
Mouse   204 AILAARSPVFRAMFEHEMEERLGNPTEIHDLDPKVFKEMMGFIYTGKAPHLQSHSMATDVLTAAD 268

  Fly   734 KYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNMIT 798
            ||.||.|||:||:|||.|||||.||:||||||||..:|||.|.:.||..||:.|.|||.|::|:.
Mouse   269 KYGLEGLKVLCEDALCRNLSVENAAQTLILADLHKREQLKTQALYFIALHASVVSETSEWKSMME 333

  Fly   799 THSHLI 804
            ||.||:
Mouse   334 THPHLV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 61/137 (45%)
BTB 645..749 CDD:279045 67/105 (64%)
BTB 656..752 CDD:197585 64/97 (66%)
SPOP_C 752..814 CDD:269807 32/53 (60%)
Tdpoz5NP_997156.2 MATH 16..153 CDD:295307 60/136 (44%)
BTB 178..284 CDD:279045 67/105 (64%)
BTB 189..287 CDD:197585 64/97 (66%)
SPOP_C 287..339 CDD:269807 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000398
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.