DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and Tdpoz2

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001007223.2 Gene:Tdpoz2 / 399673 MGIID:3027902 Length:360 Species:Mus musculus


Alignment Length:344 Identity:184/344 - (53%)
Similarity:246/344 - (71%) Gaps:2/344 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 AENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDY 538
            |:.|..||:.|.:|.|.|||:|||||...:...:||..||..||:::.|||||:|.|.|||||||
Mouse     7 AKIWGSTQISVKEFCYEWTISNFSFCMGGIRRKIKSPVFSLEANEEVAWCLRVHPNGFDEESKDY 71

  Fly   539 LSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANG 603
            ||:||:||:|.|.:|||||:|.|.|::.|:.:..:|.....|.:.::|||.|||.||.||...|.
Mouse    72 LSVYLVLVNCPKRQVRAKFEFWIKNSQGEKYQYTQSLNVPSFQRKQNWGFSKFILRDSLLSHRNW 136

  Fly   604 LLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQA 668
            |||:||||:.|:||:|...:|:.||:.|...|.|...|::|||.|::|..|:|.:|.|.|.||:|
Mouse   137 LLPKDKLTLCCKVSIVGAILNMPGQNMIPAIKDPRHMLTDDLGKLWENSLFTDCSLLVAGHEFRA 201

  Fly   669 HKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNL--EKMADDLLAA 731
            ||.||||||.||.||||.:||||..|...|.::|.:|.|||:.||||||||.|  ..||.|:|||
Mouse   202 HKVILAARSPVFRAMFEPQMEERLANCFEIQELDFQVFKEMMDFIYTGKAPTLHSHSMACDVLAA 266

  Fly   732 ADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNM 796
            ||||.||.|||:||::||.|:|||.||.|||:|||||.:|||.:.:.||..||::|.::|||::|
Mouse   267 ADKYGLEGLKVICEDSLCRNVSVENAAHTLIVADLHSTEQLKTRALHFIAVHASEVSKSSGWKSM 331

  Fly   797 ITTHSHLIAEAFRALATQQ 815
            :.:|.||:.|.||:||:.|
Mouse   332 VESHPHLVDERFRSLASAQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 72/137 (53%)
BTB 645..749 CDD:279045 63/105 (60%)
BTB 656..752 CDD:197585 60/97 (62%)
SPOP_C 752..814 CDD:269807 33/61 (54%)
Tdpoz2NP_001007223.2 MATH 16..153 CDD:295307 71/136 (52%)
BTB 178..284 CDD:279045 63/105 (60%)
BTB 189..286 CDD:197585 60/96 (63%)
SPOP_C 287..349 CDD:269807 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 1 1.000 - - FOG0000398
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.