DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and gprs

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_725599.2 Gene:gprs / 36862 FlyBaseID:FBgn0024232 Length:1302 Species:Drosophila melanogaster


Alignment Length:232 Identity:54/232 - (23%)
Similarity:90/232 - (38%) Gaps:66/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 LSEDLGNLFDNEKFSDVTLSVGG-RE-FQAHKAILAARSDVFAAMF----------EHEMEERKL 693
            |:||:..|....:..|||..||. || ..|.||:||:||.|||.|.          |...:|.||
  Fly    26 LAEDMKFLASMPELCDVTFLVGDTREPVCAVKAVLASRSRVFAKMLYAAPSPQRKRETSTKENKL 90

  Fly   694 ---------------------------------------NRVAITDVDHEVLKEMLRFIYTGKAP 719
                                                   ..:.|.:.:.:|.::::.:|:||...
  Fly    91 RLFLKRSSEPLLNLQNAAQQRTGYTQQLAPIPEPSGQQHQTLIIEEFEPDVFRQLIEYIHTGCVT 155

  Fly   720 NLEKMADDLLAAADKYALEKLKVMCEEAL--CVNLSVETAAETLILADLH----SADQLKAQTID 778
            ...:....::.|||.|.||:|:..|...:  |:|  |:|....|..|:.:    ....|..:.::
  Fly   156 LQPRTLLGVMNAADYYGLEELRRACAGFVQCCIN--VDTVCALLASAERYIQYKCTKTLVQKVLE 218

  Fly   779 FINTHATDVMETSGWQ-------NMITTHSHLIAEAF 808
            |::.|.|:|:....:.       .:|.....|.|:.|
  Fly   219 FVDEHGTEVLNLGSFTLLPQHVVRLILAREELRADEF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654 42/168 (25%)
BACK_roadkill_like 752..825 CDD:350595 13/68 (19%)
gprsNP_725599.2 BTB_POZ_BTBD19 26..184 CDD:349603 39/157 (25%)
BACK_GPRS_like 189..268 CDD:350582 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.