DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and Y59E9AL.8

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001023539.2 Gene:Y59E9AL.8 / 3565373 WormBaseID:WBGene00044346 Length:279 Species:Caenorhabditis elegans


Alignment Length:268 Identity:62/268 - (23%)
Similarity:113/268 - (42%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 NDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFV 581
            :||||..|..|     |:|.:      .|.:|....|   .:.|..:.|.|..|.:|:....:..
 Worm     8 SDKLKINLSCN-----EDSAN------TLWNCQADIV---MQLSYFDTKSEARKKLETIFEKKLF 58

  Fly   582 QGKDWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLG 646
            ..|:   |||       :|:.....|    ||.|...:..::.::  :|:...||...:..:...
 Worm    59 DSKN---KKF-------EESMDQWAE----IFNEKRELEGTIEVT--ANLKITKVQGYRKRKMFD 107

  Fly   647 NLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLR 711
            ...|:.::.|..|.|..::...:|.|::..|..|..:|....:|::...|.|..|.::.....|.
 Worm   108 YSTDHHRYFDGILLVENKKIHVNKKIMSMSSTFFENIFFCNFKEKEAKFVEIPGVSYDEFMIFLD 172

  Fly   712 FIY-TGKAPNLEK-MADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKA 774
            ||: ||:  .:|. ..::::..||.:..:.:...|||.|.....|: .|:.||||:..|..:|..
 Worm   173 FIHPTGR--QIESGFLENMMVLADLFMTDCVMNSCEEFLIKTDKVD-MAKKLILAERFSLCELMD 234

  Fly   775 QTIDFINT 782
            ..::...|
 Worm   235 HCLNSFKT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 25/103 (24%)
BTB 645..749 CDD:279045 24/105 (23%)
BTB 656..752 CDD:197585 24/97 (25%)
SPOP_C 752..814 CDD:269807 9/31 (29%)
Y59E9AL.8NP_001023539.2 BTB 117..211 CDD:197585 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.