DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and SPOPL

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001001664.1 Gene:SPOPL / 339745 HGNCID:27934 Length:392 Species:Homo sapiens


Alignment Length:392 Identity:294/392 - (75%)
Similarity:336/392 - (85%) Gaps:20/392 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 VSRVPSPPLP-EVNT-PVAENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKL 520
            :||.|:|||| :::| |:||:|||||||||||||||||||||||||||||||||||||:|.:||:
Human     1 MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSGPSDKM 65

  Fly   521 KWCLRVNPKGLDEESKDYLSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKD 585
            ||||||||||||:|||||||||||||||.|||||||||||:||||||||||||||||||||||||
Human    66 KWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAYRFVQGKD 130

  Fly   586 WGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFD 650
            |||||||||||||||||||||:||||:|||||||.|||||||.:|....|||||:|:||||||::
Human   131 WGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLKVPECRLAEDLGNLWE 195

  Fly   651 NEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYT 715
            |.:|:|.:..|.|:||:|||::|||||.||.|||||||||.|.|||.|.|:|.||.|||:|||||
Human   196 NTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYT 260

  Fly   716 GKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFI 780
            |:||||:||||:|||||||||||:||||||||||.|||||..|:||:|||||||:|||||.||||
Human   261 GRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFI 325

  Fly   781 N------------------THATDVMETSGWQNMITTHSHLIAEAFRALATQQIPPIGPPRKRVK 827
            |                  ..|||:||||||::||.:|.||:||||||||:.|.|..|.||||:|
Human   326 NRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLK 390

  Fly   828 MS 829
            .|
Human   391 QS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 128/137 (93%)
BTB 645..749 CDD:279045 75/103 (73%)
BTB 656..752 CDD:197585 71/95 (75%)
SPOP_C 752..814 CDD:269807 46/79 (58%)
SPOPLNP_001001664.1 MATH 28..166 CDD:351761 128/137 (93%)
BTB_POZ_SPOPL 179..301 CDD:349652 89/121 (74%)
BACK_SPOPL 297..392 CDD:350594 54/94 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 192 1.000 Domainoid score I3224
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 1 1.000 - - FOG0000398
OrthoInspector 1 1.000 - - otm42039
orthoMCL 1 0.900 - - OOG6_101509
Panther 1 1.100 - - LDO PTHR24413
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2421
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.