DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and CG1812

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster


Alignment Length:185 Identity:46/185 - (24%)
Similarity:82/185 - (44%) Gaps:8/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 ADSVNISGQSNIVQFKVP-------ECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARS 677
            |.:|..:..:.....|:|       |..|...|..|.:.||.:||||.|....|:||:.:|||.|
  Fly     6 APAVTPAATATSAAAKIPVNPVSPEEETLLRGLNKLRNEEKLTDVTLIVEEHRFKAHRVVLAASS 70

  Fly   678 DVFAAMF-EHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEKMADDLLAAADKYALEKLK 741
            |.|.||| :..|.|.:.:.:.:..:....:..::.:|||..........:::||||....:.::.
  Fly    71 DYFCAMFADCAMIESRKDEINLYGIKARAMGSIIDYIYTSMLELNYDNIEEILAAATHVQVREVI 135

  Fly   742 VMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNM 796
            ..|...|...:.:|.......:||::....|..:...::..|..:...||.::.|
  Fly   136 DRCTIFLGAKIEMENCLAIAGMADIYGIMDLSERAYRYMCAHFEEFATTSDFKEM 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity