DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and RGD1566337

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:XP_003749378.2 Gene:RGD1566337 / 310589 RGDID:1566337 Length:364 Species:Rattus norvegicus


Alignment Length:357 Identity:186/357 - (52%)
Similarity:244/357 - (68%) Gaps:2/357 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 AENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDY 538
            |:::.||...|..|.|.|||:|||||.:.:.|.:.|..||..||::::||||::|.|.|||||||
  Rat     7 AKSYGYTHSSVQNFCYEWTISNFSFCMDGIRENIASPVFSFEANEEVEWCLRIHPNGFDEESKDY 71

  Fly   539 LSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANG 603
            ||:||.|:||..|.|.||.:|.|:||:.|:.:..:.....||:..:.||||.||.|||||...:.
  Rat    72 LSVYLWLLSCPDSPVLAKVQFWIINAQGEKHQISKMPNVLRFMPNQLWGFKNFILRDFLLSHRHW 136

  Fly   604 LLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQA 668
            |||||:||:.|:||:|....:....:.|...:.....||:|||.|::|..|:|.:|.|.|:||:|
  Rat   137 LLPEDQLTLCCKVSIVGPFFSRPEHNTIPAIRDQRQVLSDDLGELWENFIFTDCSLVVAGQEFRA 201

  Fly   669 HKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNL--EKMADDLLAA 731
            |||||||||.||.|||||||.|...||:.|.|:...|.|||:.||||||||:|  ..||..||||
  Rat   202 HKAILAARSPVFRAMFEHEMLESLTNRIEIHDIHLHVFKEMMGFIYTGKAPHLHSHSMATRLLAA 266

  Fly   732 ADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNM 796
            ||.|.|:.||||||:|||.|||||.|..||||||.||.:.||.:.:|||..||::|.||.||::|
  Rat   267 ADMYDLQDLKVMCEDALCRNLSVENAVSTLILADFHSTEHLKTKAMDFIILHASEVSETLGWKSM 331

  Fly   797 ITTHSHLIAEAFRALATQQIPPIGPPRKRVKM 828
            :.:|.||:.||||:||:.|.|.:.|..||.|:
  Rat   332 VESHPHLVEEAFRSLASIQCPFLEPSLKRRKI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 70/137 (51%)
BTB 645..749 CDD:279045 65/105 (62%)
BTB 656..752 CDD:197585 62/97 (64%)
SPOP_C 752..814 CDD:269807 35/61 (57%)
RGD1566337XP_003749378.2 MATH 16..153 CDD:351761 69/136 (51%)
BTB_POZ 165..292 CDD:365784 75/126 (60%)
BACK 287..353 CDD:421692 36/65 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 1 1.000 - - FOG0000398
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.