DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and AT5G03550

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001318469.1 Gene:AT5G03550 / 28720565 AraportID:AT5G03550 Length:110 Species:Arabidopsis thaliana


Alignment Length:55 Identity:12/55 - (21%)
Similarity:26/55 - (47%) Gaps:13/55 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 DYLSLYLLLVSCNKS-------EVRAKFKFSILNA------KREETKAMESQRAY 578
            |:|...|.:||..|.       |::.:.|..::.|      :::|.|.::.|.::
plant    42 DWLQSKLDMVSLEKKTSEERILELKLEVKKLVMTATDLNSERKKEKKKLKKQPSW 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 12/55 (22%)
BTB_POZ_roadkill-like 637..757 CDD:349654
BACK_roadkill_like 752..825 CDD:350595
AT5G03550NP_001318469.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.