DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and BTBD8

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001363060.1 Gene:BTBD8 / 284697 HGNCID:21019 Length:1792 Species:Homo sapiens


Alignment Length:158 Identity:51/158 - (32%)
Similarity:72/158 - (45%) Gaps:11/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   637 PECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDV 701
            |..:|.|||..|:......|:.:.|.|:.|:||:|||:|||..||||......|.....|.:..:
Human   188 PASELGEDLLKLYVKPCCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGI 252

  Fly   702 DHEVLKEMLRFIYTGKAPNLEKM-ADDLLAAADKYALEKLKVMCEEAL----C------VNLSVE 755
            .|..|..|:.|||.|.....:|. ...:|..||.|.||.||.:....|    |      |..::.
Human   253 SHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLT 317

  Fly   756 TAAETLILADLHSADQLKAQTIDFINTH 783
            :..|.||:|.....:.|.|..:.:|..|
Human   318 SILECLIIAHSVGVESLFADCMKWIVKH 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB 645..749 CDD:279045 37/108 (34%)
BTB 656..752 CDD:197585 37/106 (35%)
SPOP_C 752..814 CDD:269807 8/32 (25%)
BTBD8NP_001363060.1 BTB1_POZ_BTBD8 43..147 CDD:349594
BTB2_POZ_BTBD8 189..309 CDD:349595 41/119 (34%)
BACK_BTBD8 316..378 CDD:350565 8/30 (27%)
BACK 396..>451 CDD:391941
DUF4596 1749..1792 CDD:373786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.