DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and Tdpoz1

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_683751.2 Gene:Tdpoz1 / 207213 MGIID:2449436 Length:365 Species:Mus musculus


Alignment Length:349 Identity:178/349 - (51%)
Similarity:240/349 - (68%) Gaps:2/349 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 ENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYL 539
            |||..||..|.||.|.|||:|||||...:...:.|..||:..|.::.|||||.|||.|:||||||
Mouse     8 ENWGSTQSSVEKFCYKWTISNFSFCMGGIQRRITSPVFSSEENKEVAWCLRVYPKGADKESKDYL 72

  Fly   540 SLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGL 604
            |:||:|:|..:..|.|||||.|:|::.|:.:.::|.....|:..:..|||||:.||.||...|.|
Mouse    73 SVYLVLLSHLQIPVWAKFKFWIINSQGEKYQKIKSPTVECFLTNEQNGFKKFLPRDLLLSHRNCL 137

  Fly   605 LPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAH 669
            ||||:|||.|:|:::....|:..|:.....|.|...|::|||.|::|..|:|..|.|.|.||:||
Mouse   138 LPEDQLTICCKVTILGRKYNMPSQNITPAIKDPRHLLTDDLGELWENSLFTDCCLLVAGHEFRAH 202

  Fly   670 KAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNL--EKMADDLLAAA 732
            ||||||||.||.|||||||:|.....:.|.:::.:|.|||:.||||||||:|  ..||.|:|.||
Mouse   203 KAILAARSPVFRAMFEHEMKESLKTPIKIHNLNPQVFKEMMGFIYTGKAPHLHSHSMACDVLPAA 267

  Fly   733 DKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNMI 797
            |||.|..|||:||:|||.||||:.|..|||||||||.::||.|.:|||..:|::|.|||.|::::
Mouse   268 DKYGLVSLKVLCEDALCRNLSVKNATHTLILADLHSTEKLKTQALDFIAYYASEVCETSEWKSIL 332

  Fly   798 TTHSHLIAEAFRALATQQIPPIGP 821
            .:|.||:||||::||:.|...:.|
Mouse   333 ESHPHLVAEAFQSLASAQCSFLEP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 67/137 (49%)
BTB 645..749 CDD:279045 61/105 (58%)
BTB 656..752 CDD:197585 58/97 (60%)
SPOP_C 752..814 CDD:269807 34/61 (56%)
Tdpoz1NP_683751.2 MATH 16..154 CDD:295307 67/137 (49%)
BTB 178..284 CDD:279045 61/105 (58%)
BTB 189..287 CDD:197585 58/97 (60%)
SPOP_C 287..349 CDD:269807 34/61 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 1 1.000 - - FOG0000398
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.