DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and btb-12

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_494028.2 Gene:btb-12 / 191109 WormBaseID:WBGene00022555 Length:261 Species:Caenorhabditis elegans


Alignment Length:289 Identity:59/289 - (20%)
Similarity:108/289 - (37%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 LKWCLRVNPKGLDEESKDY------LSLYLLLVSCNKSEVRAKFKFSILNAKREET--KAMESQR 576
            |::||..|.|.....|..|      |.:::     ::.:.|.:|.:|.....|..|  .....|.
 Worm    10 LQFCLLRNNKKKFHFSASYVDNDGQLEIFM-----DRLKKRLRFGWSCNCESRLNTHHAFYAFQD 69

  Fly   577 AYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKL 641
            |.||.||| :...|..|.|..|                          ::.::.:.:::      
 Worm    70 ASRFPQGK-YQRHKCARYDLYL--------------------------VALETPLAEYE------ 101

  Fly   642 SEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVL 706
                 .:|...:.:|..|.|..:....:|..|:..|..||.:|       |.:.:.|.|:.:|..
 Worm   102 -----KMFSESEDTDAVLVVEDKRLHVNKEFLSLHSTYFAELF-------KKSEITIEDLSYEDF 154

  Fly   707 KEMLRFIYTGKA-PNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSAD 770
            ..::..||.... || :..|:.:|..|.::.:.....:.|..| ::.|..:..:.|:|||.:...
 Worm   155 GLLMSNIYPKVIFPN-DFTAEKILELAVRFKVPAAVALVENQL-LHHSTLSHGKLLLLADKYEMH 217

  Fly   771 QLKAQTIDFINT--------HATDVMETS 791
            :|..|.:..|.|        .:|:..|.|
 Worm   218 RLSGQQVRKIYTKEVAEKLRRSTEYSELS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 24/108 (22%)
BTB 645..749 CDD:279045 22/104 (21%)
BTB 656..752 CDD:197585 22/96 (23%)
SPOP_C 752..814 CDD:269807 12/48 (25%)
btb-12NP_494028.2 BTB 111..200 CDD:197585 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.