DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and btb-5

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001317757.1 Gene:btb-5 / 189221 WormBaseID:WBGene00021042 Length:307 Species:Caenorhabditis elegans


Alignment Length:337 Identity:74/337 - (21%)
Similarity:119/337 - (35%) Gaps:105/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 VVKFSYMWTINNFSFCREEMGEVLKSSTFSAGAND--KLKWCLRVNPKGL------DEESKDYLS 540
            |:||               ..|::|....|..|::  .||||.|.:...:      ||:..||  
 Worm     5 VIKF---------------QSEIIKVQGGSGLAHEVKGLKWCWRSSFTPMTYDDYDDEDGFDY-- 52

  Fly   541 LYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLL 605
                       |...:|..:                 :.|    ||...|             |.
 Worm    53 -----------ETNGQFMLT-----------------WNF----DWSELK-------------LA 72

  Fly   606 PEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDN------------------- 651
            ..|::|....|..||...|||.....|....|:..|.::..:.:.|                   
 Worm    73 EVDRITGSIVVKPVAGKSNISLMQIEVDMNNPKQSLVKNFNHPYKNLGLVAFEYVFCLHYNPRVI 137

  Fly   652 --EKF-----SDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEM 709
              |.|     :|..|.|.|::....||.|:..|..|..:|....:|.:|..:.|.||.:|....:
 Worm   138 YKEMFLPSDETDAVLVVDGKKIYVCKAFLSFHSSYFRKLFSSNFKEAQLTEIPIRDVSYEDFCLL 202

  Fly   710 LRFIYTGKAPNL----EKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSAD 770
            |..||    ||:    ::.||.||..||::.:..:..|....||.:..:| ..:.:.|||.:|..
 Worm   203 LSTIY----PNMIFPNDETADKLLELADRFLMPAVTNMVGFHLCHSDKLE-CEQLIFLADKYSIP 262

  Fly   771 QLKAQTIDFINT 782
            :|..:.|..:::
 Worm   263 RLLEKVISRLDS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 27/144 (19%)
BTB 645..749 CDD:279045 31/133 (23%)
BTB 656..752 CDD:197585 30/99 (30%)
SPOP_C 752..814 CDD:269807 7/31 (23%)
btb-5NP_001317757.1 BTB 138..244 CDD:366225 32/109 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.