DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and btb-20

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_497016.1 Gene:btb-20 / 186442 WormBaseID:WBGene00010193 Length:300 Species:Caenorhabditis elegans


Alignment Length:307 Identity:69/307 - (22%)
Similarity:127/307 - (41%) Gaps:59/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 YMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEES-----KDYLSLYLLLVSC 548
            |.:|.::|.:.| |..:||.:|....     ||...:.....:.|::     .|:..|..|.:..
 Worm     8 YKFTCSSFYYGR-ETSQVLNTSITKG-----LKCVWKTRYASIAEQAFFSWEFDWNELKRLGIDS 66

  Fly   549 NKSEVRAK-FKFSILNAK---REETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDK 609
            ....:..| ...|.||.:   |:.|:.:|  ||: :::..|:.:..:|.:               
 Worm    67 LAGNITVKSASMSPLNVQIDLRKPTEIVE--RAF-YLRDDDYAYNSYINK--------------- 113

  Fly   610 LTIFCEVSVVADSVNISGQSNIVQFKVPEC-KLSEDL-GNLFDNEKFSDVTLSVGGREFQAHKAI 672
             |.| |.|.                 ||.| ::.|.| ..:|.....:|..|.:|.::....||.
 Worm   114 -TTF-EYSF-----------------VPYCAQVDESLYEKMFLPSDENDAILVIGNKKLHVCKAF 159

  Fly   673 LAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKA-PNLEKMADDLLAAADKYA 736
            |:..|..|.|:|....:|.:::.:.|.||.::....||..||.... || ::..:.||...|::.
 Worm   160 LSYHSSFFRAIFSSAFKEGQMSEIPIKDVTYKDFALMLSTIYPDAVFPN-DRTVEKLLEMGDRFI 223

  Fly   737 LEKLKVMCEEALCVNLSVETAAETLI-LADLHSADQLKAQTIDFINT 782
            ::.:....|..|..|.|:  ..|.|: :||.:...:|..::|..:|:
 Worm   224 IQSVINHVEYHLLHNTSI--GNEKLMWMADRYGMPKLLVKSIQQMNS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 29/140 (21%)
BTB 645..749 CDD:279045 26/105 (25%)
BTB 656..752 CDD:197585 25/96 (26%)
SPOP_C 752..814 CDD:269807 8/32 (25%)
btb-20NP_497016.1 BTB 143..239 CDD:197585 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.