DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and math-25

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001364702.1 Gene:math-25 / 183516 WormBaseID:WBGene00016720 Length:412 Species:Caenorhabditis elegans


Alignment Length:248 Identity:50/248 - (20%)
Similarity:90/248 - (36%) Gaps:69/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 LKWCLRVNPKGLDEESKDYLSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGK 584
            :.|.|.:..|      :.:|.|.|   .|...|...|.|:|.      :||......|   |.||
 Worm    34 IPWRLCIFKK------EGFLGLNL---HCETKECFEKKKWSF------QTKFTMKLVA---VSGK 80

  Fly   585 DWGFKKFIRRDFLLDEANGLLPEDKLTIFCEV---SVVADSVNISGQSNIVQFKVPECKLSEDLG 646
              .|::.::.:|...|.:|:   ||...:..:   .|..||:.|...:|||:             
 Worm    81 --FFRRTVQYEFQKPEGHGM---DKFISWENMLRDYVDNDSIIIEIHANI
VR------------- 127

  Fly   647 NLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLR 711
                         |.|..|.:..|.:.....|.|  :.:|..  :.::|....:.||...:|...
 Worm   128 -------------STGFFERKYFKYLQPNSDDTF--VLKHTF--KNISRFLQYEADHSDSEEHFN 175

  Fly   712 FIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILA 764
            ..:..:...|    ::.||         :.::||:.:|...|:|...|..:::
 Worm   176 IPWRVEIRKL----NEFLA---------IYLLCEQEICEERSIECVLEFRLIS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 24/103 (23%)
BTB 645..749 CDD:279045 16/103 (16%)
BTB 656..752 CDD:197585 17/95 (18%)
SPOP_C 752..814 CDD:269807 3/13 (23%)
math-25NP_001364702.1 MATH 12..125 CDD:334312 27/113 (24%)
MATH 154..264 CDD:334312 13/77 (17%)
MATH 287..386 CDD:334312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.