DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and math-10

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_494103.1 Gene:math-10 / 182669 WormBaseID:WBGene00015839 Length:309 Species:Caenorhabditis elegans


Alignment Length:215 Identity:45/215 - (20%)
Similarity:81/215 - (37%) Gaps:57/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 NTPVAENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEE 534
            :||     |.....:..|....|:.|.|...|......:.:|     ...:.|.:::      :.
 Worm   131 DTP-----CDEDENIETFLLSNTVKNISSIEEGDDYYTEIAT-----RHNVPWRMQI------KR 179

  Fly   535 SKDYLSLYLLLVSCNKSE-------VRAKFKFSILNAKREETKAMESQRAYR-FVQGKDWGFKKF 591
            :..:..|||   .|.|.|       :...:...:::...:.....:|....: |.:    ||:||
 Worm   180 NNGFFELYL---RCEKEEQPEWGWKIELDYDLRLVSLNGQSLSLTDSGSFSKPFCE----GFEKF 237

  Fly   592 IR----------RDFLLDEANGLLPEDKLT--IFCEVSVVADSVNISGQSNIVQFKVPECKLSED 644
            :|          :|.::.||.|     |:|  |.|:    .||.:..|:....: ...|...|.|
 Worm   238 MRWNIMEENYIVKDSIIIEARG-----KITKMIGCD----DDSSSDDGEDESSK-SHSESDTSSD 292

  Fly   645 LGNLFDNEKFSDVTLSVGGR 664
              ||.|  :||:..::|||:
 Worm   293 --NLED--EFSECVINVGGQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 28/157 (18%)
BTB 645..749 CDD:279045 8/20 (40%)
BTB 656..752 CDD:197585 3/9 (33%)
SPOP_C 752..814 CDD:269807
math-10NP_494103.1 MATH 14..126 CDD:279285
MATH 149..261 CDD:279285 22/134 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.