DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and hpo-9

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_504839.1 Gene:hpo-9 / 179117 WormBaseID:WBGene00015463 Length:581 Species:Caenorhabditis elegans


Alignment Length:235 Identity:61/235 - (25%)
Similarity:105/235 - (44%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 DEANGLLPEDKLTIFCEVSVVADSVNI--SGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSV 661
            ::..|::.    |:..|.:.::::.|.  |...::||..   .:||:....:|.:...|||||.:
 Worm    13 EDGRGIVE----TMRTESAAISNNFNAVNSVNKSVVQHL---DELSQSFDEIFTSTDHSDVTLVL 70

  Fly   662 -GGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEKMA 725
             .|.||.||:.|||.||..|.||.....:|.....|.:.:.:....:.:||::||.|........
 Worm    71 DDGTEFAAHRLILAVRSSFFRAMLYTGFQESHQQLVTLQETNSVAFRAVLRYMYTSKIDFAGVEL 135

  Fly   726 D---DLLAAADKYALEKL---------KVMCEEALCVNLSVETAAETLILADLHSADQLKAQTID 778
            |   :.|:.|.:|.|.:|         :::..|.||   |:..||......||          ||
 Worm   136 DILLEYLSLAHRYDLIQLMTAISEYFKEILKNENLC---SIFNAAYFFQFTDL----------ID 187

  Fly   779 FI----NTHATDVMETSGWQNMITTHS--HLIA-EAFRAL 811
            :.    :.||..::|...: |.::..|  .|:| ::|.||
 Worm   188 YCMQYSDKHADQLLEDPSF-NRLSGDSLKELLARDSFFAL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 3/21 (14%)
BTB 645..749 CDD:279045 33/116 (28%)
BTB 656..752 CDD:197585 33/108 (31%)
SPOP_C 752..814 CDD:269807 17/67 (25%)
hpo-9NP_504839.1 BTB_POZ_BTBD9 42..161 CDD:349596 36/121 (30%)
BACK_BTBD9 165..265 CDD:350518 20/76 (26%)
F5_F8_type_C 461..557 CDD:366285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.