DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and bath-42

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_498784.1 Gene:bath-42 / 176152 WormBaseID:WBGene00016803 Length:410 Species:Caenorhabditis elegans


Alignment Length:418 Identity:114/418 - (27%)
Similarity:190/418 - (45%) Gaps:58/418 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 SSTMAVSRVPS------PPLP---EVNTPVAENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLK 508
            |||..::|..|      ||.|   ||.:..|     |:|..:.....|.|..|    |::.:::|
 Worm     8 SSTEQINRTISSRADDLPPQPRRLEVVSKQA-----TRVTALSTKLEWKIEQF----EKLMKLIK 63

  Fly   509 ------SSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCNKSE--VRAKFKFSILNAK 565
                  |..||......:.|.|.|.|.|..:|..:.:|.:|..|...:.|  :..:|:...|:|.
 Worm    64 NGSNLISRMFSVPDAPTVCWELHVYPNGKRDEDVNNVSFFLRQVGLARGEEPIMTEFQIYALDAN 128

  Fly   566 REETKAMESQRAYRFVQGKDWGFKKF-IRRDFLLDEANGLLPED-KLTIFCEVSVVADSVNISGQ 628
            .:........:.:...||:.    || :.||.:|    |.|..| .|.:.|||........||.:
 Worm   129 NQRVSVCRDTKDFTNQQGRG----KFQVSRDKML----GALRSDGTLFLICEVEYFPPGSKISVE 185

  Fly   629 -------SNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEH 686
                   |...|.::||..:..:..:::::|.|:|..:.||.:..:||:.||...|.||.:||..
 Worm   186 PVVDEDVSTEEQEEMPEVIVRANNRSMWEDELFTDCVIHVGNKHIKAHRCILGQNSPVFKSMFSS 250

  Fly   687 -EMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEKMA--DDLLAAADKYALEKLKVMCEEAL 748
             .|.|.:...:.|.|..::.::.|:.|:|||...:||...  |::||.||||.:..||..||..:
 Worm   251 PNMIEAQKGEIHIEDAKYDSVRAMVEFMYTGATESLESQGNIDEILAIADKYEVLMLKDQCERLI 315

  Fly   749 CVNLSVETAAETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNMITTHSHLIAEAFRAL-- 811
            ...::::...:..:.:|.::||.||:..|.|:.||...|::|..|.::..:...|..|...|:  
 Worm   316 AQTINLKNVTQIAMFSDTYTADYLKSAVIRFLTTHHRVVIKTQDWISLKKSRHELANELLEAVLS 380

  Fly   812 -------ATQQIP-PIGPP--RKRVKMS 829
                   .|..|| .:.||  |||::.|
 Worm   381 TDQDDDDVTSNIPISVSPPPARKRLRRS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 35/147 (24%)
BTB 645..749 CDD:279045 36/106 (34%)
BTB 656..752 CDD:197585 34/98 (35%)
SPOP_C 752..814 CDD:269807 15/70 (21%)
bath-42NP_498784.1 MATH 47..174 CDD:238068 34/138 (25%)
BTB 212..315 CDD:279045 36/102 (35%)
BTB 220..319 CDD:197585 34/98 (35%)
SPOP_C 319..380 CDD:269807 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.