DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and R10E4.1

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_497854.1 Gene:R10E4.1 / 175550 WormBaseID:WBGene00011198 Length:377 Species:Caenorhabditis elegans


Alignment Length:259 Identity:58/259 - (22%)
Similarity:99/259 - (38%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 LDEESKDYLSLYLLLVSCNKSEVR--------------------AKFKFSILNAKREETKAMESQ 575
            ||||.|.|  .|.:.:.|.|.::.                    |:.:|.|   :...|.::.|:
 Worm    32 LDEEHKVY--RYWIHLKCMKWQIELRANSFECFAAYFKTPATWSAEVEFEI---RAHVTNSVRSE 91

  Fly   576 R-AYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKL-TIFCEVSVVADSVNISGQSNIVQFKVPE 638
            : ..|:.......|:....:|.::.|        || ::..|::|           |:::     
 Worm    92 KFTGRYTGSNHVYFRPLKLQDHMVRE--------KLRSMRVEITV-----------NVIK----- 132

  Fly   639 CKLSEDLGNLFDNEKFSDV-------TLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRV 696
               :.:.|.|:|   :.||       .|.|..|..:.:|..|:..|..|.|:|..|:.|      
 Worm   133 ---TMNFGMLYD---YFDVLPEEENALLKVEDRLIRVNKRYLSMMSPFFKALFYGELGE------ 185

  Fly   697 AITDVDHEV--LKE-------MLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVN 751
                 |.|:  :||       .||.||..:.|..:|..|.||..||:|..:.:...||..:|.:
 Worm   186 -----DKEIYEMKEKFREIITFLRCIYPHRQPVTKKSLDYLLQLADRYQCQPIVDACEMFMCAH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 22/111 (20%)
BTB 645..749 CDD:279045 34/119 (29%)
BTB 656..752 CDD:197585 32/112 (29%)
SPOP_C 752..814 CDD:269807 58/259 (22%)
R10E4.1NP_497854.1 BTB 154..244 CDD:366225 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.