Sequence 1: | NP_650326.3 | Gene: | rdx / 41704 | FlyBaseID: | FBgn0264493 | Length: | 829 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496626.1 | Gene: | btb-14 / 174877 | WormBaseID: | WBGene00013275 | Length: | 316 | Species: | Caenorhabditis elegans |
Alignment Length: | 264 | Identity: | 54/264 - (20%) |
---|---|---|---|
Similarity: | 94/264 - (35%) | Gaps: | 76/264 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 590 KFIRRDFLLDEANGLLPEDKLT---IFCEVSVVAD---------------------------SVN 624
Fly 625 ISGQSNIVQFKVPECKLSEDLGNLFDN------------------------------EKF----- 654
Fly 655 -SDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLN-RVAITDVDHEVLKEMLRFIY-TG 716
Fly 717 KAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAA--ETL-ILADLHSADQLKAQTID 778
Fly 779 FINT 782 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rdx | NP_650326.3 | MATH_SPOP | 483..621 | CDD:239743 | 11/33 (33%) |
BTB | 645..749 | CDD:279045 | 25/141 (18%) | ||
BTB | 656..752 | CDD:197585 | 23/97 (24%) | ||
SPOP_C | 752..814 | CDD:269807 | 11/34 (32%) | ||
btb-14 | NP_496626.1 | BTB | 148..253 | CDD:279045 | 23/105 (22%) |
BTB | 159..256 | CDD:197585 | 24/101 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |