DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and btb-14

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_496626.1 Gene:btb-14 / 174877 WormBaseID:WBGene00013275 Length:316 Species:Caenorhabditis elegans


Alignment Length:264 Identity:54/264 - (20%)
Similarity:94/264 - (35%) Gaps:76/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 KFIRRDFLLDEANGLLPEDKLT---IFCEVSVVAD---------------------------SVN 624
            ::.|.|...|.:||....|..|   |.||..|.:|                           :||
 Worm    27 EYTRGDIEFDSSNGEKIIDISTTKGIRCEWKVSSDYYTACFKWKFIWDQVDKYEVAGFSGQITVN 91

  Fly   625 ISGQSNIVQFKVPECKLSEDLGNLFDN------------------------------EKF----- 654
            .:..|...:.:..:..|::..|.::.|                              :|:     
 Worm    92 YTTDSEGQKTRTVKVNLTDPGGEIWYNVSRSRYLSTYYASYNYTLEPQKRHMEAMELDKYFAPVD 156

  Fly   655 -SDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLN-RVAITDVDHEVLKEMLRFIY-TG 716
             .|..|.|.|::.......|:..|..|..:||::.....|| .:.:..|.:|.|..:|..:: |.
 Worm   157 DRDAVLIVEGKKLHVSSCFLSFHSTYFHDLFEYDNSTSLLNIEIPVEGVSYEDLGLLLSVVHSTA 221

  Fly   717 KAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAA--ETL-ILADLHSADQLKAQTID 778
            ..|| :..:..||..|.::....:..:.|..|..|    |.|  ||| :|||.:...:|..::|.
 Worm   222 TFPN-DGNSKKLLELASQFQTPYVLGLVENHLLTN----TFAWNETLMLLADKYGLMRLLGKSIR 281

  Fly   779 FINT 782
            .|::
 Worm   282 RIDS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 11/33 (33%)
BTB 645..749 CDD:279045 25/141 (18%)
BTB 656..752 CDD:197585 23/97 (24%)
SPOP_C 752..814 CDD:269807 11/34 (32%)
btb-14NP_496626.1 BTB 148..253 CDD:279045 23/105 (22%)
BTB 159..256 CDD:197585 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.