DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and btb-2

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_871995.1 Gene:btb-2 / 174061 WormBaseID:WBGene00020802 Length:288 Species:Caenorhabditis elegans


Alignment Length:311 Identity:69/311 - (22%)
Similarity:109/311 - (35%) Gaps:108/311 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 FCREEMGEVLKSSTFSAGANDK------LKWCLRVNPKGLDE-ESKDYLSLYLLLVSCNKSEVRA 555
            ||....|.:..|...|...::|      |||         || :.|....|:..:......::..
 Worm    22 FCDTNCGGINVSLFVSETTSNKYRFEWELKW---------DELKKKGVKHLFGTITPETNDKLVP 77

  Fly   556 KFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVA 620
            ...||:  .::..|..:|:        .|||.:.               :| .|..||.:.|   
 Worm    78 SIDFSV--DEKRSTSNLET--------SKDWLYN---------------IP-FKYKIFYKES--- 113

  Fly   621 DSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFE 685
               :.||.:               |..||...:.:|..|.:||.:...:||:|:..|:.|.|:|.
 Worm   114 ---DYSGLT---------------LEELFKPSERNDAVLVIGGTKMHVNKALLSFHSEYFRALFS 160

  Fly   686 HEMEERKLNRVAITDVDHEVLKEMLRFIYTGKA----PNLEKM---------------------- 724
            ...:|.||..:.:.:|.:|....||..:|..:|    .|||||                      
 Worm   161 SNFKEGKLTEIPMYEVSYEDFSRMLAVLYGNEALLKDDNLEKMLELADQFQVPRVTAHIETHLCH 225

  Fly   725 -----ADDLLAAADKYAL--------------EKLKVMCEEALCVNLSVET 756
                 .|.|:..|||:.|              :|:|.:...|:..|||.||
 Worm   226 FSKMKQDQLMRLADKFNLRTIIEKIISEVDTTQKMKNLKNSAVFWNLSDET 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 25/129 (19%)
BTB 645..749 CDD:279045 37/148 (25%)
BTB 656..752 CDD:197585 34/140 (24%)
SPOP_C 752..814 CDD:269807 4/5 (80%)
btb-2NP_871995.1 BTB 131..227 CDD:197585 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.