DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and bath-30

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_494512.2 Gene:bath-30 / 173678 WormBaseID:WBGene00017460 Length:314 Species:Caenorhabditis elegans


Alignment Length:312 Identity:71/312 - (22%)
Similarity:129/312 - (41%) Gaps:54/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 KFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCNK 550
            :|...:..|:.|...|   ..::.||.....|  :.|..::      :.:...|.:||   .|.|
 Worm    10 EFVIRYVFNDVSNMNE---NDMRISTVEEYFN--VPWIFQI------QRNNGNLGIYL---RCRK 60

  Fly   551 ----------SEVRAKFKFSILNAKREETKAMESQRAYRFVQGK---DWGFKKFIRRDFLLDEAN 602
                      :|:..|. .|:.:..|::  ..::...:....||   .:|:.:||..:.|  |.:
 Worm    61 LKGQEMWSMFTELELKL-ISVYSDTRDQ--KCKTDMCFGHDSGKFYSSYGWSEFISWNEL--ETS 120

  Fly   603 GLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEK--FSDVTLSVGGRE 665
            .:   |..:|..|..|:   :|.|     :.|..|:      |.| ||.:|  :||:.:.|.|:.
 Worm   121 FM---DAGSITVEARVI---INKS-----IGFYTPK------LMN-FDEKKKEYSDIVVLVDGQR 167

  Fly   666 FQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEKMADDLLA 730
            |...|..||..|..|.::|.....|.||..|.:.|:|.:..::.|..:|.....| :...:.:|.
 Worm   168 FYLLKKFLAFHSTFFESLFLGGFYEAKLTEVPLYDIDVDDFQKFLEVLYGFPVIN-DNTVEGILL 231

  Fly   731 AADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINT 782
            .||.|....:..:||:.| :..:.:|..:.|.:|...:.:.||...|..|.:
 Worm   232 LADMYQTPLVSELCEDFL-IQTTGKTYKKKLQMAIKFNLENLKQFCISMIKS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 28/147 (19%)
BTB 645..749 CDD:279045 31/105 (30%)
BTB 656..752 CDD:197585 26/95 (27%)
SPOP_C 752..814 CDD:269807 7/31 (23%)
bath-30NP_494512.2 MATH 17..135 CDD:279285 27/142 (19%)
BTB 152..250 CDD:279045 28/99 (28%)
BTB 158..253 CDD:197585 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.