DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and btb-17

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_872000.1 Gene:btb-17 / 173673 WormBaseID:WBGene00018200 Length:321 Species:Caenorhabditis elegans


Alignment Length:244 Identity:54/244 - (22%)
Similarity:99/244 - (40%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 NKSEVRAKFKFSILNAKRE---------ETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGL 604
            |.|::...:||....|..|         :.|...:|.:..|..|::..|          ...:.|
 Worm    57 NNSQINFTWKFEYDEAGNEDIDEIAGTIDVKFRRNQVSGMFQTGQNQNF----------TTVHTL 111

  Fly   605 LPEDKLTIFCEVSVVADSVNISGQSNIVQFK-----VPECK-LSEDLGNLFDNEKFSDVTLSVGG 663
            :   .||..|:  .:...|.:..|...|:..     ||... |......:|.:.|.:|..|.:|.
 Worm   112 V---SLTEHCQ--TLTKLVEVPNQPGAVEVMYVYALVPWINPLQFSFDEMFLSSKKNDAVLVIGE 171

  Fly   664 REFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEKMADDL 728
            |:...:||.|:..||.|.|:|....:|.|.:.:.:.||.:|....::..||.......::.|:.:
 Worm   172 RKLHVNKAFLSYHSDYFRALFSSNFKEDKQDEIELKDVVYEDFGLLMTTIYPKTEFPSDRTAEKI 236

  Fly   729 LAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTI 777
            |..||::.::......|..|..|..: |....:.:||.:..::|..::|
 Worm   237 LEMADRFMVQSAIDHVEYHLLHNSRI-TNESMMWMADKYGMEKLMKKSI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 15/80 (19%)
BTB 645..749 CDD:279045 26/103 (25%)
BTB 656..752 CDD:197585 25/95 (26%)
SPOP_C 752..814 CDD:269807 5/26 (19%)
btb-17NP_872000.1 BTB 164..260 CDD:197585 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.