DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and KBTBD3

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_689646.2 Gene:KBTBD3 / 143879 HGNCID:22934 Length:612 Species:Homo sapiens


Alignment Length:168 Identity:43/168 - (25%)
Similarity:75/168 - (44%) Gaps:16/168 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 LSEDLG--------NLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVA 697
            :|||.|        |..:...|.|..:.:.......|:.:|||.||.|.||||..|:||....|.
Human    30 VSEDHGQKILSVLQNFREQNVFYDFKIIMKDEIIPCHRCVLAACSDFFRAMFEVNMKERDDGSVT 94

  Fly   698 ITDVDHEVLKEMLRFIYTGKAPNLEKMADD----LLAAADKYALEKLKVMCEEALCVNLSVETAA 758
            ||::..:.:|..|.:.||||.    |:.||    ....:....:..|...|.:.|..::::....
Human    95 ITNLSSKAVKAFLDYAYTGKT----KITDDNVEMFFQLSSFLQVSFLSKACSDFLIKSINLVNCL 155

  Fly   759 ETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNM 796
            :.|.::|.:.:..|....:.|:..|.:.:.::|.:..|
Human   156 QLLSISDSYGSTSLFDHALHFVQHHFSLLFKSSDFLEM 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB 645..749 CDD:279045 32/115 (28%)
BTB 656..752 CDD:197585 30/99 (30%)
SPOP_C 752..814 CDD:269807 7/45 (16%)
KBTBD3NP_689646.2 BTB_POZ_KBTBD3_BKLHD3 28..157 CDD:349580 36/130 (28%)
PHA03098 56..586 CDD:222983 36/142 (25%)
BACK_KBTBD3 149..230 CDD:350555 7/45 (16%)
Kelch 1. /evidence=ECO:0000255 295..341
KELCH repeat 334..389 CDD:276965
Kelch 2. /evidence=ECO:0000255 343..403
KELCH repeat 393..441 CDD:276965
Kelch 3. /evidence=ECO:0000255 404..454
KELCH repeat 444..489 CDD:276965
Kelch 4. /evidence=ECO:0000255 456..506
KELCH repeat 541..586 CDD:276965
Kelch 5. /evidence=ECO:0000255 552..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.