DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and KLHL40

DIOPT Version :10

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_689606.2 Gene:KLHL40 / 131377 HGNCID:30372 Length:621 Species:Homo sapiens


Alignment Length:145 Identity:42/145 - (28%)
Similarity:67/145 - (46%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 LSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEV 705
            |.:.|.::.|:.||.|..:..|.|||..|:.:|||.|..|.|.|..|.|  :...:.:.:|..:|
Human    19 LQDGLKDMLDHGKFLDCVVRAGEREFPCHRLVLAACSPYFRARFLAEPE--RAGELHLEEVSPDV 81

  Fly   706 LKEMLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSAD 770
            :.::|.::||.:....|....||.|||.::.:..:..:|...|...|.:........|..|....
Human    82 VAQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTICVSFLQKRLCLSNCLAVFRLGLLLDCA 146

  Fly   771 QLKAQTIDFINTHAT 785
            :|.....|||..|.|
Human   147 RLAVAARDFICAHFT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB_POZ_roadkill-like 637..757 CDD:349654 34/115 (30%)
BACK_roadkill_like 752..825 CDD:350595 9/34 (26%)
KLHL40NP_689606.2 BTB_POZ_KLHL40_KBTBD5 6..137 CDD:349649 34/119 (29%)
PHA03098 47..551 CDD:222983 32/117 (27%)
BACK 128..230 CDD:475122 9/34 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
KELCH repeat 351..398 CDD:276965
Kelch 1 360..412
KELCH repeat 402..448 CDD:276965
Kelch 2 413..462
KELCH repeat 452..497 CDD:276965
Kelch 3 463..510
Kelch 4 512..557
Kelch_1 547..594 CDD:396078
KELCH repeat 547..594 CDD:276965
Kelch 5 559..613
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.