DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and Btbd8

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:NP_001365195.1 Gene:Btbd8 / 100503185 MGIID:3646208 Length:1751 Species:Mus musculus


Alignment Length:378 Identity:78/378 - (20%)
Similarity:138/378 - (36%) Gaps:131/378 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 ESKDYLSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFV--QGKDWGFKKF-IRRD 595
            |:.::.:...::.|.||            |.|..|.:.::..:....:  :|.|..|.:: ...|
Mouse   106 EASEFKAFLQIVYSSNK------------NIKNYEEEIVKKLKVGSLMPEKGPDVSFPRYRTSSD 158

  Fly   596 FLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKV-----PECKLSEDLGNLFDNEKFS 655
            ..|  ..|.:|||                |:|..:....|.     |..:|..||..|:.::.:.
Mouse   159 CFL--GKGEIPED----------------ITGGGDCFISKADSDLEPASELGGDLLKLYLSQHYP 205

  Fly   656 DVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPN 720
            |:.:.|.||.|:||:|||:|||..||||......|.....:.:..:.|..:..|:.|||.|....
Mouse   206 DIDICVDGRSFRAHRAILSARSSYFAAMLSGCWAESSQECITLQGITHVEMNVMMHFIYGGTLDF 270

  Fly   721 LEKM-ADDLLAAADKYALEKLKVM---------CE-------------------------EAL-- 748
            .||. ...:|..||.|.||.|:.:         |.                         |:|  
Mouse   271 PEKANVGQILNVADMYGLEGLREVAIYVLRRDYCNFFQKPVPRTWASILECLIIAHSVGVESLFA 335

  Fly   749 -----------------------------CVNLSVET-----------AAETLIL---------A 764
                                         |:::.:::           .::.||:         |
Mouse   336 DCMNCIISHFARFWSERSFANVPPEIQKTCLSMQIQSLNHGNAAFLLMESDRLIMGLPRVKWTEA 400

  Fly   765 DLHSADQLKAQTIDFINTHATDVMETSGW------QNMITTHSHLIAEAFRAL 811
            .|..|.||:.:.:.||..:.:.::|:..:      |.|.:| :||:.:.|:|:
Mouse   401 ALSMASQLQEECVTFIVENFSQIIESENFTLLLQSQAMSST-AHLLDKIFKAI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 16/89 (18%)
BTB 645..749 CDD:279045 38/169 (22%)
BTB 656..752 CDD:197585 37/161 (23%)
SPOP_C 752..814 CDD:269807 17/86 (20%)
Btbd8NP_001365195.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..37
BTB1_POZ_BTBD8 43..146 CDD:349594 7/51 (14%)
BTB2_POZ_BTBD8 188..308 CDD:349595 38/119 (32%)
BACK_BTBD8 316..377 CDD:350565 3/60 (5%)
BACK <405..436 CDD:350515 6/30 (20%)
DUF4596 1707..1751 CDD:405945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.