DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdx and spopl

DIOPT Version :9

Sequence 1:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster
Sequence 2:XP_002933996.2 Gene:spopl / 100497988 XenbaseID:XB-GENE-5871532 Length:392 Species:Xenopus tropicalis


Alignment Length:392 Identity:280/392 - (71%)
Similarity:322/392 - (82%) Gaps:28/392 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 LPEVNT----------PVAENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKL 520
            :|||.|          ||||:||||||||||||||||||||||||||.||||||||||:|.||||
 Frog     1 MPEVATAVSSAEMSSPPVAESWCYTQVKVVKFSYMWTINNFSFCREETGEVLKSSTFSSGPNDKL 65

  Fly   521 KWCLRVNPKGLDEESKDYLSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKD 585
            ||||||||||||:|||||||||||||||.|:|||||||||:||:|.|||||||||||||||||||
 Frog    66 KWCLRVNPKGLDDESKDYLSLYLLLVSCPKNEVRAKFKFSLLNSKNEETKAMESQRAYRFVQGKD 130

  Fly   586 WGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFD 650
            |||||:|||||||||||||||:||||::||||||.|||||||||:....|||||:|:||:|.|::
 Frog   131 WGFKKYIRRDFLLDEANGLLPDDKLTLYCEVSVVQDSVNISGQSSSNNLKVPECRLAEDMGYLWE 195

  Fly   651 NEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYT 715
            |.:|:|.:|.|.|:||:|||:||||||.||:|||||.|:|.:.|||.|.|||.||.|||:|||||
 Frog   196 NRRFTDCSLFVEGKEFKAHKSILAARSPVFSAMFEHPMQESRKNRVYIRDVDPEVFKEMMRFIYT 260

  Fly   716 GKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFI 780
            |.||:|:.|||.|||||||||||:|||||||:||.||:||..|:.|||||||||:|||||.||||
 Frog   261 GGAPHLDMMADKLLAAADKYALERLKVMCEESLCNNLTVENVADVLILADLHSAEQLKAQAIDFI 325

  Fly   781 N------------------THATDVMETSGWQNMITTHSHLIAEAFRALATQQIPPIGPPRKRVK 827
            |                  ....|:|||:||::||.:|.||:||||||||:.|.||.|.||||:|
 Frog   326 NRCSVLGQLGCKDRKNCNSNQTMDIMETAGWKSMIKSHPHLVAEAFRALASAQCPPFGIPRKRLK 390

  Fly   828 MS 829
            .|
 Frog   391 QS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743 124/137 (91%)
BTB 645..749 CDD:279045 70/103 (68%)
BTB 656..752 CDD:197585 68/95 (72%)
SPOP_C 752..814 CDD:269807 42/79 (53%)
spoplXP_002933996.2 MATH 28..166 CDD:351761 124/137 (91%)
BTB_POZ 179..301 CDD:365784 83/121 (69%)
BACK_SPOPL 297..392 CDD:350594 51/94 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4144
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D864323at2759
OrthoFinder 1 1.000 - - FOG0000398
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24413
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.