DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rdx and kbtbd3

DIOPT Version :9

Sequence 1:	NP_650326.3	Gene:	rdx / 41704	FlyBaseID:	FBgn0264493	Length:	829	Species:	Drosophila melanogaster
Sequence 2:	XP_001342878.1	Gene:	kbtbd3 / 100003277	ZFINID:	ZDB-GENE-131016-5	Length:	595	Species:	Danio rerio

Alignment Length:	125	Identity:	36/125 - (28%)
Similarity:	57/125 - (45%)	Gaps:	0/125 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   656 DVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPN 720
            |.::.|.......|:.:|||.|..|.||||.:|.|.....|.::::..:.:...|.|.|:|:...
Zfish    35 DFSIHVQDETLLCHRCVLAACSHFFRAMFELDMRECVDGSVTLSNLSAQAVHTFLDFAYSGEIEV 99

  Fly   721 LEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFI 780
            .|...:.|...|....::.|...|.:.|..:|.|......|.||:.:.:.||....||||
Zfish   100 REDNVEMLFQMASFLQVDFLLRSCSDFLLESLDVSNCLHLLELAEGYGSTQLLRGAIDFI 159

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rdx	NP_650326.3	MATH_SPOP	483..621	CDD:239743
		BTB	645..749	CDD:279045	24/92 (26%)
		BTB	656..752	CDD:197585	25/95 (26%)
		SPOP_C	752..814	CDD:269807	11/29 (38%)
kbtbd3	XP_001342878.1	BTB	24..128	CDD:279045	24/92 (26%)
		PHA03098	37..558	CDD:222983	35/123 (28%)
		BACK	136..235	CDD:197943	9/24 (38%)
		KELCH repeat	316..368	CDD:276965
		Kelch_1	372..420	CDD:279660
		KELCH repeat	372..419	CDD:276965
		KELCH repeat	423..496	CDD:276965
		KELCH repeat	520..565	CDD:276965
		Kelch_1	522..565	CDD:279660
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910