DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9925 and CG15042

DIOPT Version :9

Sequence 1:NP_650324.1 Gene:CG9925 / 41702 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster


Alignment Length:429 Identity:76/429 - (17%)
Similarity:134/429 - (31%) Gaps:172/429 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 GHFRGEILSKDSGLFEVMNVDTGATQKVELAEIRSSCRFLENLPV--------------CLM--R 568
            ||.|..:     |.|..:....|   ::.:....:....||:|||              ||.  :
  Fly    53 GHMRSVV-----GTFYKITDQIG---EIAIGTKLTGTVLLESLPVFYVTINGPGSKLLKCLAMGQ 109

  Fly   569 VQLQNVCNIPD----------AAVPVNNAAIQM-LHKL--CAQKELLKLNMVDATTST----VDL 616
            ||||.:..:||          |...::..||.. :|.:  ||.       |:||...|    ::.
  Fly   110 VQLQELEQLPDYGEIFAFYDKAENRISRIAINAPVHPMGYCAY-------MIDAAKYTNMSGMER 167

  Fly   617 LFSSGDSRSLTTQMLPLIFTPVQEKAEVAPPKAASTPSQLPVVTHKQQKVSPQSLLLLDLPPLPP 681
            :|:..|..                             .:||.:|.|.:.|:...:          
  Fly   168 IFALPDDL-----------------------------KKLPALTIKCRLVNVAQM---------- 193

  Fly   682 SPPESPFPADVTSTKSASHVLPIKRFLFDALPKN-----LAPLGDKVNLILMNADGLP-----QT 736
                              |:...:......|..|     :|.:.::.|:..:.:..||     :.
  Fly   194 ------------------HIFITQNVRLRVLGSNGLELLVALIRNRTNIRKIPSAQLPPISGDEY 240

  Fly   737 GYITAAYFKDEKAAKEFEKILSLTSSQGA-------------------CDHNVVPGYVPN----- 777
            |.:.|   .|.:.||.|.:.......:|:                   .|...||.:..:     
  Fly   241 GNMDA---NDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYARFADGPTVPTWSKSVMKRG 302

  Fly   778 -----VGELCLAIYSEDKNWYRGVCQEVKDNMVKILFCDFGNTEYVAVRHVKPISQDLLIAVNVT 837
                 |.::.||.|  ...::|....::.....::.|.|||.|||.:.:             |:|
  Fly   303 TGDFRVWDIVLAPY--QGRYHRAKIVDIFRCRYRVYFLDFGITEYTSKK-------------NLT 352

  Fly   838 KCYINGFDKSKNFAAL--------EQFLVRKIRFLCGVK 868
            .||  ..:|:::..|.        .|..:..|..|.|:|
  Fly   353 FCY--ELEKAQHNLAFRFEILGTRRQCPIPYINILEGIK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9925NP_650324.1 zf-MYND 9..44 CDD:280009
TUDOR 109..225 CDD:278965
TUDOR 457..573 CDD:278965 16/68 (24%)
TUDOR 718..843 CDD:278965 29/158 (18%)
TUDOR 779..825 CDD:119391 11/45 (24%)
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 11/55 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.